Synthesis and characterization of the second cysteine-rich region of mouse skin PKCGh

The second cysteine-rich region of mouse skin PKCGh, peptide D, was prepared by automated solid phase peptide synthesis. In the presence of zinc and phosphatidylserine, peptide D bound [3H]phorbol 12,13-dibutyrate with high affinity (Kd = 0.91 nM). Peptide D serves as an effective surrogate for the mouse skin derived receptor, affording unique opportunities for the study of binding, affinity labeling, and solution structure related to the PKC regulatory domain. Peptide D: H2N-HKFNVHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCG-COOH